PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03941.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 240aa    MW: 26772.4 Da    PI: 7.0846
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03941.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.81.7e-1221891790
                             E--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                       B3 17 vlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
                             ++   f+++h +gk +++kt +l++  s ++Wev    +++     lt+GWk+F  a++L  gD+v+Fk++g++ f
  Rsa1.0_03941.1_g00001.1 21 TILLGFFSKHiEGK-TNQKTWKLRSdASDQTWEVIQ--EGRT----LTGGWKDFTTAHDLTIGDIVIFKHEGDMVF 89
                             55567888885555.56789999997888*****99..5554....***********************9998877 PP

2B362.47.5e-201332141799
                              E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                       B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                              +lp   +++  ++k++ ++++l +++g+sW+v ++++ ++g+y++t+GWk+F+ +n+ + gD +vF l+g+ ++++++ v+ +
  Rsa1.0_03941.1_g00001.1 133 YLPVGATSSTALNKQC-QEMILVNKEGNSWTVSFRFSESGGKYYITRGWKKFCVDNRSDIGDLFVFNLVGDGKTTPLLCVCPE 214
                              6788888888888866.5*****************************************************9999**999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.9E-15398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.54E-154103IPR015300DNA-binding pseudobarrel domain
CDDcd100173.05E-10790No hitNo description
SMARTSM010196.5E-13997IPR003340B3 DNA binding domain
PfamPF023624.7E-82289IPR003340B3 DNA binding domain
PROSITE profilePS5086310.014297IPR003340B3 DNA binding domain
SMARTSM010192.3E-14126215IPR003340B3 DNA binding domain
PfamPF023622.2E-18133214IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.0E-15133211IPR015300DNA-binding pseudobarrel domain
CDDcd100176.18E-16133203No hitNo description
PROSITE profilePS5086312.393134215IPR003340B3 DNA binding domain
SuperFamilySSF1019369.55E-16143206IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MANPHEPHFL KPLLPGFHSG TILLGFFSKH IEGKTNQKTW KLRSDASDQT WEVIQEGRTL  60
TGGWKDFTTA HDLTIGDIVI FKHEGDMVFH ATPFGPSCRE IQYTHPHIIK EEAEVDDAAM  120
IHGQCLLSPI TTYLPVGATS STALNKQCQE MILVNKEGNS WTVSFRFSES GGKYYITRGW  180
KKFCVDNRSD IGDLFVFNLV GDGKTTPLLC VCPESKECAE LLSKHLSRKR GDTASGSRVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894641e-125AC189464.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB075L03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013738983.11e-144PREDICTED: B3 domain-containing protein REM9-like
TrEMBLM4E0J01e-131M4E0J0_BRARP; Uncharacterized protein
STRINGBra022287.1-P1e-130(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.11e-51B3 family protein